PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G02130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 354aa    MW: 38966.4 Da    PI: 5.3018
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G02130.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.76.3e-5551341129
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                      +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++     + e++ewyfFs +d+ky+tg+r+nrat +g+Wkatg+dk+
  OGLUM03G02130.1   5 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEhcgIGYDEQSEWYFFSYKDRKYPTGTRTNRATMAGFWKATGRDKA 97 
                      69****************************.9***************953432233667*********************************** PP

              NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                      v++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle
  OGLUM03G02130.1  98 VHD-KSRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 134
                      ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-563139IPR003441NAC domain
PROSITE profilePS5100554.0035154IPR003441NAC domain
PfamPF023651.5E-286133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:1990110Biological Processcallus formation
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MESCVPPGFR FHPTDEELVG YYLRKKVASQ KIDLDVIRDI DLYRIEPWDL QEHCGIGYDE  60
QSEWYFFSYK DRKYPTGTRT NRATMAGFWK ATGRDKAVHD KSRLIGMRKT LVFYKGRAPN  120
GQKTDWIMHE YRLETDENAP PQRTAYPARS MVETWDYSLH ERNIMSAAAA AAFADPSAAY  180
AQMRRQHRSG RFKQEAELDG AATALLHYSS HLAELPQLES PSAAAAPLQP NPSQLATAGE  240
DDDCKGDNGG RRAKKARAAG DKVATTTDWR ALDKFVASQL SPGECGSMEA TAEAAAAAVA  300
GVSSPLDHGD DDMAALLFLN SDERDEVDRW TGLLGSGAGA SGVDGDLGIC VFDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-49213312140Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00266DAPTransfer from AT2G18060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1044270.0AC104427.2 Oryza sativa Japonica Group chromosome 3 clone OJ1015F07, complete sequence.
GenBankAC2104620.0AC210462.1 Oryza glaberrima clone OG_BBa0033I09, complete sequence.
GenBankAP0149590.0AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBankJN6340740.0JN634074.1 Oryza sativa Japonica Group secondary wall NAC transcription factor 5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630714.10.0PREDICTED: NAC domain-containing protein 37
SwissprotQ9SL411e-115NAC37_ARATH; NAC domain-containing protein 37
TrEMBLA0A0E0GG650.0A0A0E0GG65_ORYNI; Uncharacterized protein
STRINGBGIOSGA011539-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os03g03540.10.0(Oryza sativa Japonica Group)
STRINGORGLA03G0019500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36253768
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36160.11e-107NAC domain containing protein 76